PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g03747.1.p
Common NameBRADI_3g03747, LOC100822239
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HB-PHD
Protein Properties Length: 737aa    MW: 82008.5 Da    PI: 7.7446
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g03747.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.11.7e-09453497852
                       -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
          Homeobox   8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                        +  +e+L ++F+ +  p ++ +e+LA++lg++ +++  WF+N R
  Bradi3g03747.1.p 453 PPAAVEVLRKVFAVDELPARDVKEKLATELGISYEKIDKWFKNTR 497
                       567899*************************************99 PP

2PHD292.4e-10200253150
                       SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS.TBSSHHHHT CS
               PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpeg.ewlCeeCke 50 
                       +C+ C++  s  ++++++C+ +Ck ++H+kC +++ ++     g  wlC+ C +
  Bradi3g03747.1.p 200 ICSRCKSdeSVPDNKIIFCEgSCKMSYHQKCSEPPFDKILPTGGhGWLCKFCLC 253
                       6999**966666*******955*************9955555559*******86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579031.48E-11192257IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.105.7E-10197255IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS500169.659198254IPR019787Zinc finger, PHD-finger
SMARTSM002499.3E-6200252IPR001965Zinc finger, PHD-type
PfamPF006289.7E-8200253IPR019787Zinc finger, PHD-finger
PROSITE patternPS013590201251IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.604.2E-10438497IPR009057Homeodomain-like
PROSITE profilePS5007112.05443503IPR001356Homeobox domain
SuperFamilySSF466895.56E-10445511IPR009057Homeodomain-like
SMARTSM003899.0E-9445507IPR001356Homeobox domain
CDDcd000864.74E-9446507No hitNo description
PfamPF000465.3E-7452497IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 737 aa     Download sequence    Send to blast
MNTSENKSAC SIPRRSSRRR KQSSSELVSL SKRPSHRNAS SSYKLDQCSP KRTARTARNA  60
NLAKYIKNKY YRSPLSQRRS SSAVSGKTAT GPVRRRSRKR RRQNTDCDEA TRLERRARYL  120
LIKIKSEQNL LDAYSGDGWN GHSREKLKPE KELQRAKRQI IKSKIAIRDI IHQLDLYSSS  180
GNMDDSVMPP DEPVNPDNTI CSRCKSDESV PDNKIIFCEG SCKMSYHQKC SEPPFDKILP  240
TGGHGWLCKF CLCKMKILEA VNAHLGTSLT VTCPSKDIFK EATEHIGSDD GPGEDLLSEY  300
SGDEDYDPEE NDGTSSSLGR GEESISSESN CSGSPLYSPN DDIPGFISAD FTDAEGFCHA  360
NSHLEFDSGE DVTAEMVNYQ RPKRDVDYRR LNEEMFGKLA ENEKQSDDED WGVNRKKRRR  420
VDSAGGAKSV EGVSGVTSNE NLQPHRRKLF RMPPAAVEVL RKVFAVDELP ARDVKEKLAT  480
ELGISYEKID KWFKNTRCAA LRDRKAEGNS HIAGPSKSSG KRVEKAEVSG KFDSVDNSYL  540
PPLSKTIETK PESNSRPVRR RLHNKGVSLC PTSEVKETTS PTIKHCSNTH PIHLADRNIN  600
TEDRAISQVD TGPSDDPFFD AILAYPNINT SDKVVSTGDL VTLADEPFLD AMLADSHVFY  660
TERTVSREDV RGPSNDQPFL DVIENVCGLK HRLQRLEDML SSAAPGDTGT AKGDVENQLV  720
VLVPTAELKD KPQPGN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11621SRRRKQ
297101RKRRR
3416420KRRRV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570921.10.0PREDICTED: pathogenesis-related homeodomain protein
TrEMBLI1HX600.0I1HX60_BRADI; Uncharacterized protein
STRINGBRADI3G03747.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85502227
Representative plantOGRP18301539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.21e-80pathogenesis related homeodomain protein A